PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT06273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 421aa    MW: 47895.5 Da    PI: 6.328
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT06273genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.76.2e-25202249552
    RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
               +s++++s++F +pik+AA +L+v+lT+LKr+CR++GI+RWPhRk+ksl
  EMT06273 202 LSFQQVSRCFCMPIKQAAEKLNVGLTLLKRQCRELGIPRWPHRKLKSL 249
               89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.824186270IPR003035RWP-RK domain
PfamPF020422.2E-20202249IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MESFRSYGEE GDGCYFQNLK LHEEDHCFLD FRNRSIFCMY LLRQWSFEYL LEISLFYPTQ  60
HLCDTSTSST TTTTSQSCLL QDEFDATLFE GDILSFWPAL QERAHLKEVK QEPDGDAAEK  120
KHDGSGEALF SSTQHLCTNT TTAQSCFSQD QQELEARLEV HIMSLLAALE GEHHGGEKVM  180
KGEVGRDAGE KKRNGPEEKP LLSFQQVSRC FCMPIKQAAE KLNVGLTLLK RQCRELGIPR  240
WPHRKLKSLE TLIKNAQELG KPMIEVEMLR RKKKLIEERP GHIELDEVTK VLRQACFKEK  300
FKRRRLMAME GHRYTYSIAG GVVLEDDEGI VRAGVPFRRA KFKYSVEQVG KAVFDQGWLS  360
TDDGCTSRVA AGITEKWWQQ HMCDFDGAAI RAPGLELWGE SKGLPKLVIP GNDDVSTSLP  420
C
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1268274LRRKKKL
2269274RRKKKL
3301305KRRRL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703069e-41HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756209.13e-58PREDICTED: protein RKD1-like
TrEMBLM8BHT40.0M8BHT4_AEGTA; Uncharacterized protein
STRINGMLOC_12609.13e-88(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.12e-29RWP-RK domain-containing protein